PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G270700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 308aa    MW: 34284 Da    PI: 8.8769
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G270700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.55.8e-41154231178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl qrfCqqCsrfh lsefD++krsCrrrLa+hn+rrrk+++
  Manes.01G270700.1.p 154 RCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVIAAGLAQRFCQQCSRFHLLSEFDNGKRSCRRRLADHNRRRRKSHQ 231
                          6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.4E-35148216IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.565152229IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-38153230IPR004333Transcription factor, SBP-box
PfamPF031107.0E-31155228IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MLEYEWGSPS TMMLLSGDEP TEGPAQNRQI FDHYAAQSFN DNLVPQPTTN LFHHPPIHQV  60
NSLYDPRAYA IASSYTPPHP SLLSLDPITN PAGAAPSYFL VPKSEEVSRP SDYTARIGLN  120
LGGRTYFSSA EDDFVNRLYR RCRQVEAGSS NAPRCQAEGC NADLSHAKHY HRRHKVCEFH  180
SKASTVIAAG LAQRFCQQCS RFHLLSEFDN GKRSCRRRLA DHNRRRRKSH QINQETHKLQ  240
PAESARNYSS ENLTRSPPES GVHNSSSSVT VAVSPPRKFL DCFRHIPYQA TASSSSASSS  300
SLFFSSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-32147228384squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083646.10.0PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL32e-77SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A067JXX70.0A0A067JXX7_JATCU; Uncharacterized protein
STRINGPOPTR_0014s05680.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.15e-67squamosa promoter binding protein-like 8